Education › Vortex Planetarium - Astronomy Mod
Vortex Planetarium - Astronomy Mod

Vortex Planetarium - Astronomy Mod APK 1.4.3 [Paid for free][Free purchase] 43l1z

Update on: 2019-10-21

Vortex Planetarium - Astronomy Mod is a modified version of Vortex Planetarium - Astronomy developed by Magictorch Software. The difference between mod version and original version is: Paid for free... You can latest mod version or original version of how to use HappyMod to and install all kinds of file types:xapk, bapk, apks...
App name Vortex Planetarium - Astronomy Mod APK 1.4.3 [Paid for free][Free purchase]
Version 1.4.3
Update on 2019-10-21
Size 12.86 MB
Price Free
Rating 3.6
System Android 2.3 (GINGERBREAD)
Mod info Paid for free
Developer
Category Education
Get it on Google Play
original apk
Other Apps
from this developer
Vortex Planetarium - Astronomy Mod APK
Links:

Vortex Planetarium - Astronomy Mod APK 1.4.3 [Paid for free][Free purchase] 43l1z

Use HappyMod App to get faster !
* All mod apks are ed by s. If there is any infringement, please us to remove it.

# Mod Info x1919

The main advantages / modifications of Vortex Planetarium - Astronomy Mod APK 1.4.3 [Paid for free][Free purchase] 32p6j

Paid for free

# Vortex Planetarium - Astronomy Mod APK 1.4.3 [Paid for free][Free purchase] Features: 93q6z

Vortex Planetarium - Astronomy Mod (paid) 1.4.3 APK MOD is published on 2019-10-36. and install Vortex Planetarium - Astronomy Mod (paid) 1.4.3 APK file (12.86 MB). Over 37 s have this mod. They rate a 3.9 of 5 about this Mod. To install Vortex Planetarium - Astronomy Mod (paid) 1.4.3 APK file. Your android device version should be at least 4.1 and up and the device is not need root. Vortex Planetarium - Astronomy Mod (paid) 1.4.3 APK works very well on 44 s's device. The size about Vortex Planetarium - Astronomy Mod (paid) 1.4.3 APK is 12.86 MB. You can Vortex Planetarium - Astronomy Mod (paid) 1.4.3 APK to get unlimited money and win easily.

# How to and install Vortex Planetarium - Astronomy Mod APK 1.4.3 [Paid for free][Free purchase]? 694y22

// Option A // 3t371d

To Vortex Planetarium - Astronomy mod from happymod.gamesite.info.
You need enable the option "Unknown Sources".
1. Click on the above link to Vortex Planetarium - Astronomy mod APK.
2. Save the file in your device s folder.
3. Now tap on Install and wait for the installation to finish.
4. Once it is done, open the game and start playing it right away.

// Option B // 4s1q4h

To Vortex Planetarium - Astronomy from HappyMod APP, you can follow this:
1. Open your browser and the HappyMod APK file from happymod.gamesite.info - the only official website of HappyMod.
2. Open Android Settings and go into Privacy or Security.
3. Tap the option to Allow Unknown Sources and enable it.
4. Go to your Android s and tap the APK file.
5. Follow the directions on the screen to install it.
6. Search Vortex Planetarium - Astronomy in HappyMod App.

# Full Specifications of Vortex Planetarium - Astronomy Mod APK 1.4.3 [Paid for free][Free purchase] 62x45

// Information // 6k3k64

Size 12.9MB
Version 1.4.3
Version Code 59
Lang af am ar be bg ca cs da de el en-GB es es-US et fa fi fr hi hr hu in it iw ja ko lt lv ms nb nl pl pt pt-PT rm ro ru sk sl sr sv sw th tl tr uk vi zh-CN zh-TW zu

More...[+]

// Operation Systems // l425d

Permission CHECK_LICENSE ACCESS_FINE_LOCATION CAMERA SYSTEM_ALERT_WINDOW INTERNET ACCESS_NETWORK_STATE
Permission Text OTHER:
OTHER:
Allows an app to create windows using the type TYPE_SYSTEM_ALERT, shown on top of all other apps.
Allows applications to open network sockets.
Allows applications to access information about networks.
LOCATION:
Allows an app to access precise location.
CAMERA:
Required to be able to access the camera device.
Min Sdk 9
Min Sdk Txt Android 2.3 (GINGERBREAD)
Target Sdk 19
Target Sdk Txt Android 4.4 (KITKAT)
Multi Window No
s Screens small, normal, large, xlarge
U armeabi armeabi-v7a
Open GL Int 0
s Any Density Yes
Densities 120, 160, 240, 320

// Features // 6c1v56

Uses Feature Location hardware features:
The app uses precise location coordinates obtained from a Global Positioning System (GPS) receiver on the device.
Uses Feature Sensor hardware features:
The app uses motion readings from the device's accelerometer to detect the device's current orientation. For example, an app could use accelerometer readings to determine when to switch between portrait and landscape orientations.
Uses Feature The app uses precise location coordinates obtained from a Global Positioning System (GPS) receiver on the device.#:

// Signature // 1l6mr

Md5 7D1472899D5E45114896B6C8CE9CE44A
Signature 6B21E993C18EA3403A7249D0111B2092C9D3498C
Sha256 5C04889FABA6C37F8896A1F884E642474611D3EBD65854800C3FD0C6D690F115
Valid From Sat Sep 28 15:07:39 CEST 2013 until: Thu Nov 17 14:07:39 CET 2095
Serial Number a619c09

// Developer // 1k4p39

Developer Andr
OU Andr
Organization None
Locale GS
Country NA
City NA

# FAQ 3t42i


Why does the app say I have no internet connection? 2v6c


This issue may occur due to temporary server problems or app glitches. Ensure your device is connected to a stable internet connection.



What should I do if the app is lagging? 254122


Lagging can be caused by insufficient device resources. Try closing other apps or restarting your device to improve performance.



Why can't I effects? 543y28


ing effects may fail due to network issues or server problems. Check your internet connection and try again later.



How can I fix the network issue while using a VPN? h592f


Sometimes, VPNs can interfere with app connectivity. Try disconnecting the VPN and see if the app works without it.



What can I do if the app keeps crashing? 6z40


If the app crashes frequently, consider clearing the app cache or reinstalling it to resolve potential bugs.



Why can't I access AI modes in the app? 3x343


AI modes may require a stable internet connection. Ensure your connection is strong and try again.

If AI modes are not accessible, it could be due to server issues or your internet connection. Check if other apps are working properly. If they are, the issue might be with the app itself.

Steps to resolve:
1. Check your internet connection by opening a web browser.
2. Restart your device to refresh the network settings.
3. Open the app again and try accessing the AI modes.



What should I do if the app is not ing templates? x243l


If templates are not ing, it may be due to a poor internet connection or server issues. Check your connection and try again later.



Why does the app keep saying 'no internet' even with a connection? 4z5r73


This could be a bug in the app or a temporary server issue. Restarting the app or your device may help resolve this.

Persistent 'no internet' messages can indicate a problem with the app's ability to connect to its servers. Restarting can refresh the app's connection attempt.

Steps to resolve:
1. Close the app completely.
2. Restart your device.
3. Reopen the app and check the connection.



Why does the app crash when importing 4K videos? 426m2y


The app may crash due to high resource demands when handling 4K videos. Try using lower resolution files for smoother editing.

4K videos require more processing power and memory. If your device is not equipped to handle such high-resolution files, it may lead to crashes.



What should I do if I keep getting network errors? 5j1s4c


Network errors can occur due to unstable internet connections. Try switching to a different network or resetting your router.

Network issues can disrupt the app's functionality. A stable connection is essential for smooth operation, especially when using online features.



# What're s talking about Vortex Planetarium - Astronomy Mod APK 6ox40

HappyMod to real time talk with millions of s. q2t3j

  • reviews
  • requests

Write a review for Vortex Planetarium - Astronomy Mod APK akf

Rate it: 4w4p2b

Average rating out of 41 j4y3

Submit a review

reviews (41) 5f2h5a

Request a latest version of Vortex Planetarium - Astronomy Mod 536d4r

If this mod doesn't work, you can send a request to HappyMod community. s will a new mod if they've one.
Send a request

Latest requests related to Vortex Planetarium - Astronomy 485a57

I

@Anonymous   2019-08-16 17:29:51 4o1p3n

From:ID   Device:OPPO H1909   OS:android 8.1.0
ingin menggunggah mod karnaanananajoalnandndldkdbndndkdodndnempsshzndkeodjnxmslsidjdlwpqosnxndlwosdjnwloskdndleoejdmdkeiejdndkwixjekeodjdndkoskdndnmdkeodidkdmdmdlsjdbfnfndm

I

@Anonymous   2019-07-25 10:04:09 1p3d4q

From:ID   Device:OPPO A33w   OS:android 5.1
bzbzbzggvbbbvbdndbshebdanaf.af.wf qfqdnqnqfnqfnwtntwnwtnwgnwgnwgnehnwymwtnwtjwtnwtnetngwn wfmfnafnqfnwfnwfnafnwfnwfnfwmfwmwf wtntwnwtnwtbwtny.gemwt

Logo

HappyMod 311n4b

Best mod er
for 100% working mods.

Vortex Planetarium - Astronomy Mod apk ~ faster with HappyMod.

Other Versions 1ub1c

Found (1) versions of Vortex Planetarium - Astronomy Mod 504c2x

Vortex Planetarium - Astronomy Mod Apk 1.4.3 [Paid for free][Free purchase]

Vortex Planetarium - Astronomy Mod Apk 1.4.3 [Paid for free][Free purchase] 2t1b73

Paid for free

Related Mods 1o6p2n

People who Vortex Planetarium - Astronomy Mod also like... 6v3w63

VBAN Receptor Mod Apk 1.0.1 [Paid for free][Free purchase]

VBAN Receptor Mod Apk 1.0.1 [Paid for free][Free purchase] 1n484u

Paid for free
Virtual Gastric Band Hypnosis Mod Apk 3.0.11 [Paid for free][Free purchase]

Virtual Gastric Band Hypnosis Mod Apk 3.0.11 [Paid for free][Free purchase] 5k29

Paid for free
Gin Rummy Pro Mod Apk 1.193 [Paid for free][Free purchase]

Gin Rummy Pro Mod Apk 1.193 [Paid for free][Free purchase] 4i3p6w

Paid for free
ViNTERA.TV без внешней рекламы Mod Apk 1.2.7 [Paid for free][Free purchase]

ViNTERA.TV без внешней рекламы Mod Apk 1.2.7 [Paid for free][Free purchase] 6a6y1l

Paid for free
HTML+CSS Helper Pro Mod Apk 3.1 [Paid for free][Free purchase]

HTML+CSS Helper Pro Mod Apk 3.1 [Paid for free][Free purchase] n3e43

Paid for free
Speed Trap Alert Pro  Mod Apk 2.49 [Paid for free][Free purchase]

Speed Trap Alert Pro Mod Apk 2.49 [Paid for free][Free purchase] q4f13

Paid for free
Trident 3 for KWGT Mod Apk 3.3 [Paid for free][Free purchase]

Trident 3 for KWGT Mod Apk 3.3 [Paid for free][Free purchase] 3t1u54

Paid for free
Solar System Explorer HD Pro Mod Apk 2.7.9 [Paid for free][Free purchase]

Solar System Explorer HD Pro Mod Apk 2.7.9 [Paid for free][Free purchase] 3y252d

Paid for free
Gear Fit Volume Mod Apk 1.1 [Paid for free][Free purchase]

Gear Fit Volume Mod Apk 1.1 [Paid for free][Free purchase] 2l29g

Paid for free

Shake Screen On Off PRO Mod Apk 3.1 [Paid for free][Free purchase] 3f4j2c

Paid for free

More...[+]

100% working mods + super fast